[B016]Sequence Infomation
This interface provides Sequence information, including Sequence ID, sequence, sequence length, sequence type (nucleotide or protein), SEQ ID NO, sequence claim position, species
Request Parameters
List of parameters supported by this API endpoint
| Name | Type | Example | Description |
|---|---|---|---|
| integer<int64> | 524284411 | sequence_id |
Response Schema
Structure of the API response data
| Field Name | Type | Example | Description |
|---|---|---|---|
data | object | - | response data |
cdrs | object | Please check the form: BioSequenceInfoCdrs | cdrs |
abm | array | Please check the form: BioSequenceInfoCdr | abm |
hc_cdr1 | string | GYTFTNYY | hc_cdr1 |
hc_cdr2 | string | INPSNGGT | hc_cdr2 |
hc_cdr3 | string | ARRDYRFDMGFDY | hc_cdr3 |
imgt | array | Please check the form: BioSequenceInfoCdr | imgt |
kabat | array | Please check the form: BioSequenceInfoCdr | kabat |
chothia | array | Please check the form: BioSequenceInfoCdr | chothia |
contact | array | Please check the form: BioSequenceInfoCdr | contact |
type | string | Proteins | sequence type |
drugs | array | Please check the form: BioDrugInfo | drugs |
drug_id | string | 2838b95ade834c96b17ac8bcd2b68c27 | ID |
display_name | array | [
{
"lang": "EN",
"name": "Adalimumab"
},
{
"lang": "CN",
"name": "阿达木单抗"
}
] | Name |
lang | string | EN | Language |
name | string | Ranibizumab (Genentech) | Drug,Target,Organization,Disease,Country/Location,DICT,Mechanism Action Name |
genes | array | Please check the form: BioGeneInfo | genes |
name | string | A1BG | Name |
gene_id | string | 2838b95ade834c96b17ac8bcd2b68c27 | ID |
length | string | 113 aa | sequence length |
organism | array | [
"Synthetic construct"
] | organism |
sequence | string | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE | sequence |
description | string | Inteferon alpha-2 | sequence description |
is_antibody | boolean | - | is antibody |
seq_position | array | Please check the form: BioSequenceInfoClaim | seq position |
pn | string | US12084692B2 | pn |
pbdt | integer<int32> | 20250805 | pbdt |
positions | array | [
"Claim 17;",
"Claim 28;"
] | positions |
sequence_code | integer<int64> | 834879 | sequence code |
sequence_name | array | [
"RNA, (G-G-A-G-A-A-G-U-G-G-U-A-G-A-G-G-C-A-C-A)"
] | sequence name |
sequence_label | array | [
"artificial Sequence",
"mutation",
"variant"
] | sequence label |
claimed_in_patents | boolean | true | claimed in patents |
chemically_modified | boolean | - | chemically modified |
statusRequired | boolean | false | Status |
error_msg | string | The request parameter format is incorrect! | Error Message |
error_codeRequired | integer | 0 | Error Code |
Success Response Example
Example of a successful API response
JSON
{
"data": {
"cdrs": {
"abm": [
{
"hc_cdr1": "GYTFTNYY",
"hc_cdr2": "INPSNGGT",
"hc_cdr3": "ARRDYRFDMGFDY"
}
],
"imgt": [
{
"hc_cdr1": "GYTFTNYY",
"hc_cdr2": "INPSNGGT",
"hc_cdr3": "ARRDYRFDMGFDY"
}
],
"kabat": [
{
"hc_cdr1": "GYTFTNYY",
"hc_cdr2": "INPSNGGT",
"hc_cdr3": "ARRDYRFDMGFDY"
}
],
"chothia": [
{
"hc_cdr1": "GYTFTNYY",
"hc_cdr2": "INPSNGGT",
"hc_cdr3": "ARRDYRFDMGFDY"
}
],
"contact": [
{
"hc_cdr1": "GYTFTNYY",
"hc_cdr2": "INPSNGGT",
"hc_cdr3": "ARRDYRFDMGFDY"
}
]
},
"type": "Proteins",
"drugs": [
{
"drug_id": "2838b95ade834c96b17ac8bcd2b68c27",
"display_name": [
{
"lang": "EN",
"name": "Ranibizumab (Genentech)"
}
]
}
],
"genes": [
{
"name": "A1BG",
"gene_id": "2838b95ade834c96b17ac8bcd2b68c27"
}
],
"length": "113 aa",
"organism": [
"Synthetic construct"
],
"sequence": "CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE",
"description": "Inteferon alpha-2",
"is_antibody": false,
"seq_position": [
{
"pn": "US12084692B2",
"pbdt": 20250805,
"positions": [
"Claim 17;",
"Claim 28;"
]
}
],
"sequence_code": 834879,
"sequence_name": [
"RNA, (G-G-A-G-A-A-G-U-G-G-U-A-G-A-G-G-C-A-C-A)"
],
"sequence_label": [
"artificial Sequence",
"mutation",
"variant"
],
"claimed_in_patents": true,
"chemically_modified": false
},
"status": true,
"error_code": 0
}Error Codes
List of possible error codes returned by this endpoint
Business Errors
| Error Code | Description |
|---|---|
68300004 | Invalid parameter! |
68300005 | Search api failure! |
68300006 | Analytic basic access error! |
68300007 | Bad request! |
68300008 | Service error, please try again later! |
68300010 | The file does not comply with upload specifications! |
Platform Errors
| Error Code | Description |
|---|---|
67200000 | API call exceeds the total limit set by the platform! |
67200001 | API call exceeds the total limit set by the platform! |
67200002 | The current call rate is too fast, exceeding the current configuration limit QPS! |
67200003 | The key and secret parameters for applying for the token are incorrect or the client has been disabled! |
67200004 | The requested api does not have permission. Please contact our support personnel! |
67200005 | Insufficient account balance/number of calls! |
67200006 | The client has exceeded the activation validity period! |
67200007 | The current call exceeds the configured usage limit of the day! |
67200008 | Please check if the required apikey in the query parameter has been transmitted! |
67200009 | The apikey does not match the passed bearerToken. Please check if a valid token is being used! |
67200012 | The request is illegal! |
67200100 | The current server status is busy, request response timeout! |
67200101 | The API requested currently does not exist. Please check the request path! |
HTTP Status Codes
| Status Code | Description |
|---|---|
0 | Success |
201 | Created |
401 | Unauthorized |
403 | Forbidden |
404 | Not Found |
Performance Metrics
Expected performance characteristics for this endpoint
Normal Response Time
5000 ms
Max Response Time
10000 ms